![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (4 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H4 [47125] (5 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (33 PDB entries) |
![]() | Domain d2io5c1: 2io5 C:24-100 [137542] Other proteins in same PDB: d2io5a1, d2io5b_ automatically matched to d1p3ob_ |
PDB Entry: 2io5 (more details), 2.7 Å
SCOPe Domain Sequences for d2io5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io5c1 a.22.1.1 (C:24-100) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta mdvvyalkrqgrtlygf
Timeline for d2io5c1: