Lineage for d2io3b1 (2io3 B:20-93)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1637453Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1637622Protein SUMO-2 [117816] (1 species)
  7. 1637623Species Human (Homo sapiens) [TaxId:9606] [117817] (8 PDB entries)
    Uniprot P61956
  8. 1637629Domain d2io3b1: 2io3 B:20-93 [137541]
    Other proteins in same PDB: d2io3a1, d2io3c1
    automatically matched to 2CKH B:14-92

Details for d2io3b1

PDB Entry: 2io3 (more details), 3.2 Å

PDB Description: crystal structure of human senp2 in complex with rangap1-sumo-2
PDB Compounds: (B:) Small ubiquitin-related modifier 2

SCOPe Domain Sequences for d2io3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io3b1 d.15.1.1 (B:20-93) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
lkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaqleme
dedtidvfqqqtgg

SCOPe Domain Coordinates for d2io3b1:

Click to download the PDB-style file with coordinates for d2io3b1.
(The format of our PDB-style files is described here.)

Timeline for d2io3b1: