![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein SUMO-2 [117816] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117817] (12 PDB entries) Uniprot P61956 |
![]() | Domain d2io3b1: 2io3 B:20-93 [137541] Other proteins in same PDB: d2io3a1, d2io3c1 automatically matched to 2CKH B:14-92 |
PDB Entry: 2io3 (more details), 3.2 Å
SCOPe Domain Sequences for d2io3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io3b1 d.15.1.1 (B:20-93) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} lkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaqleme dedtidvfqqqtgg
Timeline for d2io3b1: