| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (8 families) ![]() |
| Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
| Protein SUMO-1 (smt3 homologue) [54241] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [54242] (14 PDB entries) Uniprot Q93068 |
| Domain d2io2b1: 2io2 B:23-97 [137540] Other proteins in same PDB: d2io2a1, d2io2c1 automatically matched to d1tgzb_ mutant |
PDB Entry: 2io2 (more details), 2.9 Å
SCOP Domain Sequences for d2io2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io2b1 d.15.1.1 (B:23-97) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]}
klkvigqdsseihfkvkmtthlkklkesycqrqgvpmnslrflfegqriadnhtpkelgm
eeedvievyqeqtgg
Timeline for d2io2b1: