![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (8 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (38 proteins) Pfam PF00240 |
![]() | Protein SUMO-2 [117816] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117817] (11 PDB entries) Uniprot P61956 |
![]() | Domain d2io1f1: 2io1 F:15-88 [137539] Other proteins in same PDB: d2io1a1, d2io1c1, d2io1e1 automatically matched to d1wm2a_ mutant |
PDB Entry: 2io1 (more details), 2.6 Å
SCOP Domain Sequences for d2io1f1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io1f1 d.15.1.1 (F:15-88) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq lemededtidvfqq
Timeline for d2io1f1: