Lineage for d2io1f_ (2io1 F:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932448Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries)
  8. 2932605Domain d2io1f_: 2io1 F: [137539]
    Other proteins in same PDB: d2io1a_, d2io1c_, d2io1e_
    automated match to d1wm2a_

Details for d2io1f_

PDB Entry: 2io1 (more details), 2.6 Å

PDB Description: crystal structure of human senp2 in complex with presumo-3
PDB Compounds: (F:) Small ubiquitin-related modifier 3 precursor

SCOPe Domain Sequences for d2io1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io1f_ d.15.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
lemededtidvfqqqtggvpe

SCOPe Domain Coordinates for d2io1f_:

Click to download the PDB-style file with coordinates for d2io1f_.
(The format of our PDB-style files is described here.)

Timeline for d2io1f_: