Lineage for d2io1d_ (2io1 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2539528Protein automated matches [190118] (17 species)
    not a true protein
  7. 2539567Species Human (Homo sapiens) [TaxId:9606] [189560] (114 PDB entries)
  8. 2539724Domain d2io1d_: 2io1 D: [137538]
    Other proteins in same PDB: d2io1a_, d2io1c_, d2io1e_
    automated match to d1wm2a_

Details for d2io1d_

PDB Entry: 2io1 (more details), 2.6 Å

PDB Description: crystal structure of human senp2 in complex with presumo-3
PDB Compounds: (D:) Small ubiquitin-related modifier 3 precursor

SCOPe Domain Sequences for d2io1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io1d_ d.15.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
lemededtidvfqqqtggvpes

SCOPe Domain Coordinates for d2io1d_:

Click to download the PDB-style file with coordinates for d2io1d_.
(The format of our PDB-style files is described here.)

Timeline for d2io1d_: