Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (9 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189560] (70 PDB entries) |
Domain d2io1d_: 2io1 D: [137538] Other proteins in same PDB: d2io1a_, d2io1c_, d2io1e_ automated match to d1wm2a_ |
PDB Entry: 2io1 (more details), 2.6 Å
SCOPe Domain Sequences for d2io1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2io1d_ d.15.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq lemededtidvfqqqtggvpes
Timeline for d2io1d_: