SCOPe 2.07: Domain d2io0b2: 2io0 B:16-95

Lineage for d2io0b2 (2io0 B:16-95)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein SUMO-2 [117816] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117817] (12 PDB entries)
   Uniprot P61956

8. Domain d2io0b2: 2io0 B:16-95 [137536]
   Other proteins in same PDB: d2io0a1, d2io0b3
   automated match to d1wm2a_
   complexed with so4

Details for d2io0b2

PDB Entry: 2io0, 2.3 Å

PDB Description: crystal structure of human senp2 in complex with presumo-2

PDB Compounds: (B:) Small ubiquitin-related modifier 2 precursor

SCOPe Domain Sequences for d2io0b2:

Sequence; same for both SEQRES and ATOM records:

>d2io0b2 d.15.1.1 (B:16-95) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
lemededtidvfqqqtggvy

Timeline for d2io0b2:

• d2io0b2 first appeared in SCOP 1.73, called d2io0b1
  
• d2io0b2 appears in SCOPe 2.06
  
• d2io0b2 appears in the current release, SCOPe 2.08