Lineage for d2io0b2 (2io0 B:16-95)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177468Protein SUMO-2 [117816] (1 species)
  7. 2177469Species Human (Homo sapiens) [TaxId:9606] [117817] (9 PDB entries)
    Uniprot P61956
  8. 2177472Domain d2io0b2: 2io0 B:16-95 [137536]
    Other proteins in same PDB: d2io0a1, d2io0b3
    automated match to d1wm2a_
    complexed with so4

Details for d2io0b2

PDB Entry: 2io0 (more details), 2.3 Å

PDB Description: crystal structure of human senp2 in complex with presumo-2
PDB Compounds: (B:) Small ubiquitin-related modifier 2 precursor

SCOPe Domain Sequences for d2io0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2io0b2 d.15.1.1 (B:16-95) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]}
dhinlkvagqdgsvvqfkikrhtplsklmkaycerqglsmrqirfrfdgqpinetdtpaq
lemededtidvfqqqtggvy

SCOPe Domain Coordinates for d2io0b2:

Click to download the PDB-style file with coordinates for d2io0b2.
(The format of our PDB-style files is described here.)

Timeline for d2io0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2io0b3
View in 3D
Domains from other chains:
(mouse over for more information)
d2io0a1