Lineage for d2inwb_ (2inw B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2210472Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2211311Superfamily d.110.8: YeeU-like [143737] (1 family) (S)
    beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer
    automatically mapped to Pfam PF06154
  5. 2211312Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins)
    Pfam PF06154
  6. 2211313Protein Hypothetical protein YeeU [143741] (2 species)
  7. 2211317Species Shigella flexneri [TaxId:623] [143743] (1 PDB entry)
    Uniprot Q83JN9 4-120
  8. 2211319Domain d2inwb_: 2inw B: [137534]
    automated match to d2inwa1
    complexed with po4

Details for d2inwb_

PDB Entry: 2inw (more details), 1.5 Å

PDB Description: Crystal structure of Q83JN9 from Shigella flexneri at high resolution. Northeast Structural Genomics Consortium target SfR137.
PDB Compounds: (B:) Putative structural protein

SCOPe Domain Sequences for d2inwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2inwb_ d.110.8.1 (B:) Hypothetical protein YeeU {Shigella flexneri [TaxId: 623]}
tlpgttppddnhdrpwwglpctvtpcfgarlvqegnrlhyladragirgrfsdvdayhld
qafpllmkqlelmltggelnprhqhtvtlyakgltceadtlgscgyvylavyptpa

SCOPe Domain Coordinates for d2inwb_:

Click to download the PDB-style file with coordinates for d2inwb_.
(The format of our PDB-style files is described here.)

Timeline for d2inwb_: