SCOP 1.75: Domain d2inwb1: 2inw B:4-119

Lineage for d2inwb1 (2inw B:4-119)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.8: YeeU-like [143737] (1 family)
   beta(2)-alpha-beta(3); 2 layers, a/b; there is an oligomerization interface instead of the 'missing' helical layer

5. Family d.110.8.1: YagB/YeeU/YfjZ-like [143738] (2 proteins)
   Pfam PF06154

6. Protein Hypothetical protein YeeU [143741] (2 species)

7. Species Shigella flexneri [TaxId:623] [143743] (1 PDB entry)
   Uniprot Q83JN9 4-120

8. Domain d2inwb1: 2inw B:4-119 [137534]
   automatically matched to 2INW A:4-120
   complexed with po4

Details for d2inwb1

PDB Entry: 2inw, 1.5 Å

PDB Description: Crystal structure of Q83JN9 from Shigella flexneri at high resolution. Northeast Structural Genomics Consortium target SfR137.

PDB Compounds: (B:) Putative structural protein

SCOP Domain Sequences for d2inwb1:

Sequence; same for both SEQRES and ATOM records:

>d2inwb1 d.110.8.1 (B:4-119) Hypothetical protein YeeU {Shigella flexneri [TaxId: 623]}
tlpgttppddnhdrpwwglpctvtpcfgarlvqegnrlhyladragirgrfsdvdayhld
qafpllmkqlelmltggelnprhqhtvtlyakgltceadtlgscgyvylavyptpa

Timeline for d2inwb1:

• d2inwb1 first appeared in SCOP 1.73
  
• d2inwb1 appears in SCOPe 2.01
  
• d2inwb1 appears in the current release, SCOPe 2.08, called d2inwb_