SCOPe 2.08: Domain d2inqb_: 2inq B:

Lineage for d2inqb_ (2inq B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (9 species)

7. Species Escherichia coli K-12 [TaxId:83333] [187149] (11 PDB entries)

8. Domain d2inqb_: 2inq B: [137532]
   automated match to d1dre__
   complexed with mt1

Details for d2inqb_

PDB Entry: 2inq, 2.2 Å

PDB Description: neutron crystal structure of escherichia coli dihydrofolate reductase bound to the anti-cancer drug, methotrexate

PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d2inqb_:

Sequence; same for both SEQRES and ATOM records:

>d2inqb_ c.71.1.1 (B:) Dihydrofolate reductase, prokaryotic type {Escherichia coli K-12 [TaxId: 83333]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d2inqb_:

• d2inqb_ first appeared in SCOP 1.73, called d2inqb1
  
• d2inqb_ appears in SCOPe 2.07