SCOP 1.73: Domain d2inqa1: 2inq A:1-159

Lineage for d2inqa1 (2inq A:1-159)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Dihydrofolate reductase, prokaryotic type [53599] (6 species)

7. Species Escherichia coli [TaxId:562] [53600] (45 PDB entries)

8. Domain d2inqa1: 2inq A:1-159 [137531]
   automatically matched to d1dre__
   complexed with mt1; mutant

Details for d2inqa1

PDB Entry: 2inq, 2.2 Å

PDB Description: neutron crystal structure of escherichia coli dihydrofolate reductase bound to the anti-cancer drug, methotrexate

PDB Compounds: (A:) dihydrofolate reductase

SCOP Domain Sequences for d2inqa1:

Sequence; same for both SEQRES and ATOM records:

>d2inqa1 c.71.1.1 (A:1-159) Dihydrofolate reductase, prokaryotic type {Escherichia coli [TaxId: 562]}
misliaalavdrvigmenampwnlpadlawfkrntldkpvimgrhtwesigrplpgrkni
ilssqpgtddrvtwvksvdeaiaacgdvpeimvigggrvyeqflpkaqklylthidaeve
gdthfpdyepddwesvfsefhdadaqnshsycfeilerr

Timeline for d2inqa1:

• d2inqa1 is new in SCOP 1.73
  
• d2inqa1 appears in SCOP 1.75
  
• d2inqa1 appears in the current release, SCOPe 2.08, called d2inqa_