Lineage for d2inea_ (2ine A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829136Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2829137Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2829201Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 2829202Species Human (Homo sapiens) [TaxId:9606] [51437] (156 PDB entries)
    Uniprot P15121
  8. 2829341Domain d2inea_: 2ine A: [137530]
    automated match to d1ads__
    complexed with nap, pac

Details for d2inea_

PDB Entry: 2ine (more details), 1.9 Å

PDB Description: crystal structure of aldose reductase complexed with phenylacetic acid
PDB Compounds: (A:) aldose reductase

SCOPe Domain Sequences for d2inea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2inea_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
srlllnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiqek
lreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgkef
fpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykpav
nqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaakhn
kttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvcall
sctshkdypfheef

SCOPe Domain Coordinates for d2inea_:

Click to download the PDB-style file with coordinates for d2inea_.
(The format of our PDB-style files is described here.)

Timeline for d2inea_: