SCOP 1.73: Domain d2indc1: 2ind C:3-85

Lineage for d2indc1 (2ind C:3-85)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.12: TmoB-like [110814] (1 family)
   possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies

5. Family d.15.12.1: TmoB-like [110815] (1 protein)
   Pfam PF06234

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (1 species)

7. Species Pseudomonas stutzeri [TaxId:316] [110817] (5 PDB entries)

8. Domain d2indc1: 2ind C:3-85 [137529]
   Other proteins in same PDB: d2inda1, d2indb1
   automatically matched to d1t0rc_
   complexed with mn, p6g

Details for d2indc1

PDB Entry: 2ind, 2.2 Å

PDB Description: mn(ii) reconstituted toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure

PDB Compounds: (C:) TouB protein

SCOP Domain Sequences for d2indc1:

Sequence; same for both SEQRES and ATOM records:

>d2indc1 d.15.12.1 (C:3-85) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

Timeline for d2indc1:

• d2indc1 is new in SCOP 1.73
  
• d2indc1 appears in SCOP 1.75
  
• d2indc1 appears in the current release, SCOPe 2.08, called d2indc_