Lineage for d2indc_ (2ind C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2935136Superfamily d.15.12: TmoB-like [110814] (2 families) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 2935137Family d.15.12.1: TmoB-like [110815] (1 protein)
    Pfam PF06234
  6. 2935138Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species)
  7. 2935151Species Pseudomonas stutzeri [TaxId:316] [110817] (6 PDB entries)
    Uniprot O87799
  8. 2935157Domain d2indc_: 2ind C: [137529]
    Other proteins in same PDB: d2inda_, d2indb_
    automated match to d1t0rc_
    complexed with mn, p6g

Details for d2indc_

PDB Entry: 2ind (more details), 2.2 Å

PDB Description: mn(ii) reconstituted toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure
PDB Compounds: (C:) TouB protein

SCOPe Domain Sequences for d2indc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2indc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

SCOPe Domain Coordinates for d2indc_:

Click to download the PDB-style file with coordinates for d2indc_.
(The format of our PDB-style files is described here.)

Timeline for d2indc_: