Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.12: TmoB-like [110814] (2 families) possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies |
Family d.15.12.1: TmoB-like [110815] (1 protein) Pfam PF06234 |
Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (2 species) |
Species Pseudomonas stutzeri [TaxId:316] [110817] (6 PDB entries) Uniprot O87799 |
Domain d2indc_: 2ind C: [137529] Other proteins in same PDB: d2inda_, d2indb_ automated match to d1t0rc_ complexed with mn, p6g |
PDB Entry: 2ind (more details), 2.2 Å
SCOPe Domain Sequences for d2indc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2indc_ d.15.12.1 (C:) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]} tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf prgmivsdaglrptetldiifmd
Timeline for d2indc_: