Lineage for d2indb_ (2ind B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729174Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 1729448Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)
  7. 1729461Species Pseudomonas stutzeri [TaxId:316] [109791] (6 PDB entries)
    Uniprot O87802
  8. 1729464Domain d2indb_: 2ind B: [137528]
    Other proteins in same PDB: d2inda_, d2indc_
    automated match to d1t0rb_
    complexed with mn, p6g

Details for d2indb_

PDB Entry: 2ind (more details), 2.2 Å

PDB Description: mn(ii) reconstituted toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure
PDB Compounds: (B:) Toluene, o-xylene monooxygenase oxygenase subunit

SCOPe Domain Sequences for d2indb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2indb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri [TaxId: 316]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmgl

SCOPe Domain Coordinates for d2indb_:

Click to download the PDB-style file with coordinates for d2indb_.
(The format of our PDB-style files is described here.)

Timeline for d2indb_: