SCOP 1.73: Domain d2indb1: 2ind B:8-330

Lineage for d2indb1 (2ind B:8-330)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (1 species)

7. Species Pseudomonas stutzeri [TaxId:316] [109791] (5 PDB entries)

8. Domain d2indb1: 2ind B:8-330 [137528]
   Other proteins in same PDB: d2inda1, d2indc1
   automatically matched to d1t0rb_
   complexed with mn, p6g

Details for d2indb1

PDB Entry: 2ind, 2.2 Å

PDB Description: mn(ii) reconstituted toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure

PDB Compounds: (B:) Toluene, o-xylene monooxygenase oxygenase subunit

SCOP Domain Sequences for d2indb1:

Sequence; same for both SEQRES and ATOM records:

>d2indb1 a.25.1.2 (B:8-330) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri [TaxId: 316]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmgl

Timeline for d2indb1:

• d2indb1 is new in SCOP 1.73
  
• d2indb1 appears in SCOP 1.75
  
• d2indb1 appears in the current release, SCOPe 2.08, called d2indb_