Lineage for d2incc1 (2inc C:3-85)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 718290Superfamily d.15.12: TmoB-like [110814] (1 family) (S)
    possibly related to the ubiquitin-like and/or 2Fe-2S ferredoxin-like superfamilies
  5. 718291Family d.15.12.1: TmoB-like [110815] (1 protein)
    Pfam PF06234
  6. 718292Protein Toluene, o-xylene monooxygenase oxygenase subunit TouB [110816] (1 species)
  7. 718293Species Pseudomonas stutzeri [TaxId:316] [110817] (5 PDB entries)
  8. 718294Domain d2incc1: 2inc C:3-85 [137526]
    Other proteins in same PDB: d2inca1, d2incb1
    automatically matched to d1t0rc_
    complexed with fe, p6g

Details for d2incc1

PDB Entry: 2inc (more details), 1.85 Å

PDB Description: native toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure
PDB Compounds: (C:) TouB protein

SCOP Domain Sequences for d2incc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2incc1 d.15.12.1 (C:3-85) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]}
tfpimsnferdfviqlvpvdtedtmdqvaekcayhsinrrvhpqpekilrvrrhedgtlf
prgmivsdaglrptetldiifmd

SCOP Domain Coordinates for d2incc1:

Click to download the PDB-style file with coordinates for d2incc1.
(The format of our PDB-style files is described here.)

Timeline for d2incc1: