SCOP 1.73: Domain d2incb1: 2inc B:8-329

Lineage for d2incb1 (2inc B:8-329)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.25: Ferritin-like [47239] (4 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (5 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (1 species)

7. Species Pseudomonas stutzeri [TaxId:316] [109791] (5 PDB entries)

8. Domain d2incb1: 2inc B:8-329 [137525]
   Other proteins in same PDB: d2inca1, d2incc1
   automatically matched to d1t0rb_
   complexed with fe, p6g

Details for d2incb1

PDB Entry: 2inc, 1.85 Å

PDB Description: native toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure

PDB Compounds: (B:) Toluene, o-xylene monooxygenase oxygenase subunit

SCOP Domain Sequences for d2incb1:

Sequence; same for both SEQRES and ATOM records:

>d2incb1 a.25.1.2 (B:8-329) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri [TaxId: 316]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmg

Timeline for d2incb1:

• d2incb1 is new in SCOP 1.73
  
• d2incb1 appears in SCOP 1.75
  
• d2incb1 appears in the current release, SCOPe 2.08, called d2incb_