SCOPe 2.08: Domain d2incb_: 2inc B:

Lineage for d2incb_ (2inc B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)

6. Protein Toluene, o-xylene monooxygenase oxygenase subunit TouE [109790] (2 species)

7. Species Pseudomonas stutzeri [TaxId:316] [109791] (6 PDB entries)
   Uniprot O87802

8. Domain d2incb_: 2inc B: [137525]
   Other proteins in same PDB: d2inca_, d2incc_
   automated match to d1t0qb_
   complexed with fe, p6g

Details for d2incb_

PDB Entry: 2inc, 1.85 Å

PDB Description: native toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure

PDB Compounds: (B:) Toluene, o-xylene monooxygenase oxygenase subunit

SCOPe Domain Sequences for d2incb_:

Sequence; same for both SEQRES and ATOM records:

>d2incb_ a.25.1.2 (B:) Toluene, o-xylene monooxygenase oxygenase subunit TouE {Pseudomonas stutzeri [TaxId: 316]}
alkplktwshlagnrrrpseyevvstnlhyftdnperpweldsnlpmqtwykkycfdspl
khddwnafrdpdqlvyrtynllqdgqesyvqglfdqlndrghdqmltrewvetlarfytp
arylfhalqmgsvyihqiapastitncatyetadhlrwlthtayrtrelancypdvgfgk
rerdvwendpawqgfreliekaliawdwgeaftainlvtkpaveeallqqlgslaqsegd
tllgllaqaqkrdaerhrrwssalvkmalekegnrevlqkwvakwepladkaieaycsal
pdgenaiveaksasryvrqmmg

Timeline for d2incb_:

• d2incb_ first appeared in SCOP 1.73, called d2incb1
  
• d2incb_ appears in SCOPe 2.07