Lineage for d2inca_ (2inc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1990025Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 protein domains)
  6. 1990279Protein Toluene, o-xylene monooxygenase oxygenase subunit TouA [109788] (2 species)
    contains the TouB(TmoB)-binding YHS (sub)domain (Pfam PF04945) in the C-terminal part (401-450)
  7. 1990292Species Pseudomonas stutzeri [TaxId:316] [109789] (6 PDB entries)
    Uniprot O87798
  8. 1990293Domain d2inca_: 2inc A: [137524]
    Other proteins in same PDB: d2incb_, d2incc_
    automated match to d1t0qa_
    complexed with fe, p6g

Details for d2inca_

PDB Entry: 2inc (more details), 1.85 Å

PDB Description: native toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure
PDB Compounds: (A:) Toluene, o-xylene monooxygenase oxygenase subunit

SCOPe Domain Sequences for d2inca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2inca_ a.25.1.2 (A:) Toluene, o-xylene monooxygenase oxygenase subunit TouA {Pseudomonas stutzeri [TaxId: 316]}
smlkredwydltrttnwtpkyvtenelfpeemsgargismeawekydepykitypeyvsi
qrekdsgaysikaalerdgfvdradpgwvstmqlhfgaialeeyaastaearmarfakap
gnrnmatfgmmdenrhgqiqlyfpyanvkrsrkwdwahkaihtnewaaiaarsffddmmm
trdsvavsimltfafetgftnmqflglaadaaeagdhtfaslissiqtdesrhaqqggps
lkilvengkkdeaqqmvdvaiwrswklfsvltgpimdyytplesrnqsfkefmlewivaq
ferqlldlgldkpwywdqfmqdldethhgmhlgvwywrptvwwdpaagvspeerewleek
ypgwndtwgqcwdvitdnlvngkpeltvpetlpticnmcnlpiahtpgnkwnvkdyqley
egrlyhfgseadrwcfqidperyknhtnlvdrflkgeiqpadlagalmymslepgvmgdd
ahdyewvkayq

SCOPe Domain Coordinates for d2inca_:

Click to download the PDB-style file with coordinates for d2inca_.
(The format of our PDB-style files is described here.)

Timeline for d2inca_: