SCOPe 2.07: Domain d2in4a_: 2in4 A:

Lineage for d2in4a_ (2in4 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (10 species)

7. Species Horse (Equus caballus) [TaxId:9796] [46474] (96 PDB entries)

8. Domain d2in4a_: 2in4 A: [137523]
   automated match to d1azi__
   complexed with he5, so4

Details for d2in4a_

PDB Entry: 2in4, 2.15 Å

PDB Description: Crystal Structure of Myoglobin with Charge Neutralized Heme, ZnDMb-dme

PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d2in4a_:

Sequence; same for both SEQRES and ATOM records:

>d2in4a_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

Timeline for d2in4a_:

• d2in4a_ first appeared in SCOP 1.73, called d2in4a1
  
• d2in4a_ appears in SCOPe 2.06
  
• d2in4a_ appears in the current release, SCOPe 2.08