SCOP 1.73: Domain d2in1b1: 2in1 B:3-164

Lineage for d2in1b1 (2in1 B:3-164)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (4 families)

5. Family d.20.1.4: UFC1-like [143072] (1 protein)

6. Protein Ufm1-conjugating enzyme 1, UFC1 [143073] (1 species)
   aka cgi-126

7. Species Human (Homo sapiens) [TaxId:9606] [143074] (2 PDB entries)

8. Domain d2in1b1: 2in1 B:3-164 [137522]
   automatically matched to 1YWZ A:1-167

Details for d2in1b1

PDB Entry: 2in1, 2.7 Å

PDB Description: Crystal Structure of the Human Ubiquitin fold conjugating enzyme 1 (Ufc1), Northeast Structural Genomics Target HR41

PDB Compounds: (B:) Ufm1-conjugating enzyme 1

SCOP Domain Sequences for d2in1b1:

Sequence; same for both SEQRES and ATOM records:

>d2in1b1 d.20.1.4 (B:3-164) Ufm1-conjugating enzyme 1, UFC1 {Human (Homo sapiens) [TaxId: 9606]}
deatrrvvseipvlktnagprdrelwvqrlkeeyqsliryvennknadndwfrlesnkeg
trwfgkcwyihdllkyefdiefdipitypttapeiavpeldgktakmyrggkicltdhfk
plwarnvpkfglahlmalglgpwlaveipdliqkgviqhkek

Timeline for d2in1b1:

• d2in1b1 is new in SCOP 1.73
  
• d2in1b1 last appears in SCOP 1.75