SCOPe 2.07: Domain d2imwp1: 2imw P:241-348

Lineage for d2imwp1 (2imw P:241-348)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DinB homolog (DBH) [100881] (3 species)

7. Species Sulfolobus solfataricus, DNA polymerase IV [TaxId:2287] [100882] (35 PDB entries)

8. Domain d2imwp1: 2imw P:241-348 [137519]
   Other proteins in same PDB: d2imwp2
   automated match to d1jx4a1
   protein/DNA complex; complexed with ca, dds, edo

Details for d2imwp1

PDB Entry: 2imw, 2.05 Å

PDB Description: mechanism of template-independent nucleotide incorporation catalyzed by a template-dependent dna polymerase

PDB Compounds: (P:) DNA polymerase IV

SCOPe Domain Sequences for d2imwp1:

Sequence; same for both SEQRES and ATOM records:

>d2imwp1 d.240.1.1 (P:241-348) DinB homolog (DBH) {Sulfolobus solfataricus, DNA polymerase IV [TaxId: 2287]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfieaigldk

Timeline for d2imwp1:

• d2imwp1 first appeared in SCOP 1.73
  
• d2imwp1 appears in SCOPe 2.06
  
• d2imwp1 appears in the current release, SCOPe 2.08