Lineage for d2imoa2 (2imo A:213-329)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2561203Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) (S)
  5. 2561204Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)
  6. 2561205Protein Allantoate amidohydrolase AllC [143401] (1 species)
  7. 2561206Species Escherichia coli [TaxId:562] [143402] (2 PDB entries)
    Uniprot P77425 211-327
  8. 2561209Domain d2imoa2: 2imo A:213-329 [137516]
    Other proteins in same PDB: d2imoa1, d2imoa3, d2imob1, d2imob3
    automated match to d1z2la2

Details for d2imoa2

PDB Entry: 2imo (more details), 2.8 Å

PDB Description: crystal structure of allantoate amidohydrolase from escherichia coli at ph 4.6
PDB Compounds: (A:) Allantoate amidohydrolase

SCOPe Domain Sequences for d2imoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imoa2 d.58.19.1 (A:213-329) Allantoate amidohydrolase AllC {Escherichia coli [TaxId: 562]}
vgqrrytvtlngesnhagttpmgyrrdtvyafsrichqsvekakrmgdplvltfgkvepr
pntvnvvpgkttftidcrhtdaavlrdftqqlendmraicdemdigididlwmdeep

SCOPe Domain Coordinates for d2imoa2:

Click to download the PDB-style file with coordinates for d2imoa2.
(The format of our PDB-style files is described here.)

Timeline for d2imoa2: