SCOPe 2.08: Domain d2imoa2: 2imo A:213-329

Lineage for d2imoa2 (2imo A:213-329)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family)

5. Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins)

6. Protein Allantoate amidohydrolase AllC [143401] (1 species)

7. Species Escherichia coli [TaxId:562] [143402] (2 PDB entries)
   Uniprot P77425 211-327

8. Domain d2imoa2: 2imo A:213-329 [137516]
   Other proteins in same PDB: d2imoa1, d2imoa3, d2imob1, d2imob3
   automated match to d1z2la2

Details for d2imoa2

PDB Entry: 2imo, 2.8 Å

PDB Description: crystal structure of allantoate amidohydrolase from escherichia coli at ph 4.6

PDB Compounds: (A:) Allantoate amidohydrolase

SCOPe Domain Sequences for d2imoa2:

Sequence; same for both SEQRES and ATOM records:

>d2imoa2 d.58.19.1 (A:213-329) Allantoate amidohydrolase AllC {Escherichia coli [TaxId: 562]}
vgqrrytvtlngesnhagttpmgyrrdtvyafsrichqsvekakrmgdplvltfgkvepr
pntvnvvpgkttftidcrhtdaavlrdftqqlendmraicdemdigididlwmdeep

Timeline for d2imoa2:

• d2imoa2 first appeared in SCOP 1.73
  
• d2imoa2 appears in SCOPe 2.07