Lineage for d2imoa1 (2imo A:4-212,A:330-413)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2142305Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2142521Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (18 proteins)
  6. 2142522Protein Allantoate amidohydrolase AllC catalytic domain [142514] (1 species)
  7. 2142523Species Escherichia coli [TaxId:562] [142515] (2 PDB entries)
    Uniprot P77425 2-210,328-411
  8. 2142526Domain d2imoa1: 2imo A:4-212,A:330-413 [137515]
    Other proteins in same PDB: d2imoa2, d2imoa3, d2imob2, d2imob3
    automated match to d1z2la1

Details for d2imoa1

PDB Entry: 2imo (more details), 2.8 Å

PDB Description: crystal structure of allantoate amidohydrolase from escherichia coli at ph 4.6
PDB Compounds: (A:) Allantoate amidohydrolase

SCOPe Domain Sequences for d2imoa1:

Sequence, based on SEQRES records: (download)

>d2imoa1 c.56.5.4 (A:4-212,A:330-413) Allantoate amidohydrolase AllC catalytic domain {Escherichia coli [TaxId: 562]}
ithfrqaieetlpwlssfgadpaggmtrllyspewletqqqfkkrmaasgletrfdevgn
lygrlngteypqevvlsgshidtvvnggnldgqfgalaawlaidwlktqygaplrtvevv
amaeeegsrfpyvfwgsknifglanpddvrnicdakgnsfvdamkacgftlpnapltprq
dikafvelhieqgcvlesngqsigvvnaiXvpmnkelvatltelcereklnyrvmhsgag
hdaqifaprvptcmifipsingishnpaertnitdlaegvktlalmlyqlawqk

Sequence, based on observed residues (ATOM records): (download)

>d2imoa1 c.56.5.4 (A:4-212,A:330-413) Allantoate amidohydrolase AllC catalytic domain {Escherichia coli [TaxId: 562]}
ithfrqaieetlpwlssfgadmtrllyspewletqqqfkkrmaasgletrfdevgnlygr
lngteypqevvlsgshidtvvnggnldgqfgalaawlaidwlktqygaplrtvevvamae
eegsrfpyvfwgsknifglanpddvnsfvdamkacgftlpnapltprqdikafvelhieq
gcvlesngqsigvvnaiXvpmnkelvatltelcereklnyrvmhsgaghdaqifaprvpt
cmifipsingishnpaertnitdlaegvktlalmlyqlawqk

SCOPe Domain Coordinates for d2imoa1:

Click to download the PDB-style file with coordinates for d2imoa1.
(The format of our PDB-style files is described here.)

Timeline for d2imoa1: