Lineage for d2imba2 (2imb A:1-418)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205348Family d.92.1.7: Clostridium neurotoxins, catalytic domain [55512] (2 proteins)
  6. 2205349Protein Botulinum neurotoxin [55513] (4 species)
  7. 2205350Species Clostridium botulinum, serotype A [TaxId:1491] [55514] (26 PDB entries)
    Uniprot P10845 1-419
  8. 2205378Domain d2imba2: 2imb A:1-418 [137511]
    Other proteins in same PDB: d2imba3, d2imbb3
    automated match to d1xtga_
    complexed with ahl, zn

Details for d2imba2

PDB Entry: 2imb (more details), 2.41 Å

PDB Description: clostridium botulinum neurotoxin serotype a light chain inhibited by l-arginine hydroxamate
PDB Compounds: (A:) Botulinum neurotoxin A light-chain

SCOPe Domain Sequences for d2imba2:

Sequence, based on SEQRES records: (download)

>d2imba2 d.92.1.7 (A:1-418) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
mqfvnkqfnykdpvngvdiayikipnvgqmqpvkafkihnkiwviperdtftnpeegdln
pppeakqvpvsyydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwgg
stidtelkvidtncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngy
gstqyirfspdftfgfeeslevdtnpllgagkfatdpavtlahelihaghrlygiainpn
rvfkvntnayyemsglevsfeelrtfgghdakfidslqenefrlyyynkfkdiastlnka
ksivgttaslqymknvfkekyllsedtsgkfsvdklkfdklykmlteiytednfvkffkv
lnrktylnfdkavfkinivpkvnytiydgfnlrntnlaanfngqnteinnmnftklkn

Sequence, based on observed residues (ATOM records): (download)

>d2imba2 d.92.1.7 (A:1-418) Botulinum neurotoxin {Clostridium botulinum, serotype A [TaxId: 1491]}
mqfvnkqfnykdpvngvdiayikipvkafkihnkiwviperdtftnpeegdlnppvpvsy
ydstylstdnekdnylkgvtklferiystdlgrmlltsivrgipfwggstidtelkvidt
ncinviqpdgsyrseelnlviigpsadiiqfecksfghevlnltrngygstqyirfspdf
tfgfeeslagkfatdpavtlahelihaghrlygiainpnrvfkevsfeelrtfgghdakf
idslqenefrlyyynkfkdiastlnkaksivgaslqymknvfkekyllsedtsgkfsvdk
lkfdklykmlteiytednfvkffkvlnrktylnfdkavfkinivpkvnytiydgfnlrnt
nlaanfngqnteinnmnftklkn

SCOPe Domain Coordinates for d2imba2:

Click to download the PDB-style file with coordinates for d2imba2.
(The format of our PDB-style files is described here.)

Timeline for d2imba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2imba3