Lineage for d2im9a1 (2im9 A:49-352)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155317Family d.3.1.13: Lpg0564-like [142864] (1 protein)
    Pfam PF07313, DUF1460; contains new PDB entry 2p1g, annotated as putative xylanase
  6. 2155318Protein Hypothetical protein Lpg0564 [142865] (1 species)
  7. 2155319Species Legionella pneumophila [TaxId:446] [142866] (1 PDB entry)
    Uniprot Q5ZY11 49-352
  8. 2155320Domain d2im9a1: 2im9 A:49-352 [137508]

Details for d2im9a1

PDB Entry: 2im9 (more details), 1.67 Å

PDB Description: Crystal structure of protein LPG0564 from Legionella pneumophila str. Philadelphia 1, Pfam DUF1460
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2im9a1:

Sequence, based on SEQRES records: (download)

>d2im9a1 d.3.1.13 (A:49-352) Hypothetical protein Lpg0564 {Legionella pneumophila [TaxId: 446]}
nsaaieeqanssirklyhtlntmpntsmadrisqisayfkgtkyilgslgegpnarydqf
pryrvdgfdcdtyvntvlslalanslesfqeclkhtrykngkrsyinrnhftsidwnnyn
qkrgllkditfsirnekkqpvalyanalinkpqwynhktidtirlqkqdkneqekrlvel
kakgktletslsnvpyipftalfsenkpnlhlfsqipngavieiirpnwdlrqqigteld
ishlgfaiwinnelffrqassqygkvvdvslidyldkarssptikginiqvvlpekpvsn
gcqlf

Sequence, based on observed residues (ATOM records): (download)

>d2im9a1 d.3.1.13 (A:49-352) Hypothetical protein Lpg0564 {Legionella pneumophila [TaxId: 446]}
nsaaieeqanssirklyhtlnttsmadrisqisayfkgtkyilgslgegpnarydqfpry
rvdgfdcdtyvntvlslalanslesfqeclkhtrykngkrsyinrnhftsidwnnynqkr
gllkditfsirnekkqpvalyanalinkpqwynhktidtirlqkqdkneqekrlvelkak
gktletslsnvpyipftalfsenkpnlhlfsqipngavieiirpnwdlrqqigteldish
lgfaiwinnelffrqassqygkvvdvslidyldkarssptikginiqvvlpekpvcqlf

SCOPe Domain Coordinates for d2im9a1:

Click to download the PDB-style file with coordinates for d2im9a1.
(The format of our PDB-style files is described here.)

Timeline for d2im9a1: