Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.13: Lpg0564-like [142864] (1 protein) Pfam PF07313, DUF1460; contains new PDB entry 2p1g, annotated as putative xylanase |
Protein Hypothetical protein Lpg0564 [142865] (1 species) |
Species Legionella pneumophila [TaxId:446] [142866] (1 PDB entry) Uniprot Q5ZY11 49-352 |
Domain d2im9a1: 2im9 A:49-352 [137508] |
PDB Entry: 2im9 (more details), 1.67 Å
SCOPe Domain Sequences for d2im9a1:
Sequence, based on SEQRES records: (download)
>d2im9a1 d.3.1.13 (A:49-352) Hypothetical protein Lpg0564 {Legionella pneumophila [TaxId: 446]} nsaaieeqanssirklyhtlntmpntsmadrisqisayfkgtkyilgslgegpnarydqf pryrvdgfdcdtyvntvlslalanslesfqeclkhtrykngkrsyinrnhftsidwnnyn qkrgllkditfsirnekkqpvalyanalinkpqwynhktidtirlqkqdkneqekrlvel kakgktletslsnvpyipftalfsenkpnlhlfsqipngavieiirpnwdlrqqigteld ishlgfaiwinnelffrqassqygkvvdvslidyldkarssptikginiqvvlpekpvsn gcqlf
>d2im9a1 d.3.1.13 (A:49-352) Hypothetical protein Lpg0564 {Legionella pneumophila [TaxId: 446]} nsaaieeqanssirklyhtlnttsmadrisqisayfkgtkyilgslgegpnarydqfpry rvdgfdcdtyvntvlslalanslesfqeclkhtrykngkrsyinrnhftsidwnnynqkr gllkditfsirnekkqpvalyanalinkpqwynhktidtirlqkqdkneqekrlvelkak gktletslsnvpyipftalfsenkpnlhlfsqipngavieiirpnwdlrqqigteldish lgfaiwinnelffrqassqygkvvdvslidyldkarssptikginiqvvlpekpvcqlf
Timeline for d2im9a1: