![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.26: YppE-like [140415] (1 family) ![]() flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3 |
![]() | Family a.24.26.1: YppE-like [140416] (3 proteins) Pfam PF08807; DUF1798 |
![]() | Protein Hypothetical protein YppE [140421] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [140422] (2 PDB entries) |
![]() | Domain d2im8b1: 2im8 B:1-119 [137507] automatically matched to 2HFI A:1-123 complexed with po4 |
PDB Entry: 2im8 (more details), 2 Å
SCOP Domain Sequences for d2im8b1:
Sequence, based on SEQRES records: (download)
>d2im8b1 a.24.26.1 (B:1-119) Hypothetical protein YppE {Bacillus subtilis [TaxId: 1423]} mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiar
>d2im8b1 a.24.26.1 (B:1-119) Hypothetical protein YppE {Bacillus subtilis [TaxId: 1423]} mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale likvrrphkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiar
Timeline for d2im8b1: