Lineage for d2im8b1 (2im8 B:1-119)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638486Superfamily a.24.26: YppE-like [140415] (1 family) (S)
    flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3
  5. 638487Family a.24.26.1: YppE-like [140416] (3 proteins)
    Pfam PF08807; DUF1798
  6. 638494Protein Hypothetical protein YppE [140421] (1 species)
  7. 638495Species Bacillus subtilis [TaxId:1423] [140422] (2 PDB entries)
  8. 638497Domain d2im8b1: 2im8 B:1-119 [137507]
    automatically matched to 2HFI A:1-123
    complexed with po4

Details for d2im8b1

PDB Entry: 2im8 (more details), 2 Å

PDB Description: X-Ray Crystal Structure of Protein yppE from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR213.
PDB Compounds: (B:) Hypothetical protein yppE

SCOP Domain Sequences for d2im8b1:

Sequence, based on SEQRES records: (download)

>d2im8b1 a.24.26.1 (B:1-119) Hypothetical protein YppE {Bacillus subtilis [TaxId: 1423]}
mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiar

Sequence, based on observed residues (ATOM records): (download)

>d2im8b1 a.24.26.1 (B:1-119) Hypothetical protein YppE {Bacillus subtilis [TaxId: 1423]}
mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
likvrrphkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiar

SCOP Domain Coordinates for d2im8b1:

Click to download the PDB-style file with coordinates for d2im8b1.
(The format of our PDB-style files is described here.)

Timeline for d2im8b1: