![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.26: YppE-like [140415] (1 family) ![]() flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3 automatically mapped to Pfam PF08807 |
![]() | Family a.24.26.1: YppE-like [140416] (3 proteins) Pfam PF08807; DUF1798 |
![]() | Protein Hypothetical protein YppE [140421] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [140422] (2 PDB entries) Uniprot P50833 1-123 |
![]() | Domain d2im8b_: 2im8 B: [137507] automated match to d2hfia1 complexed with po4 |
PDB Entry: 2im8 (more details), 2 Å
SCOPe Domain Sequences for d2im8b_:
Sequence, based on SEQRES records: (download)
>d2im8b_ a.24.26.1 (B:) Hypothetical protein YppE {Bacillus subtilis [TaxId: 1423]} mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiar
>d2im8b_ a.24.26.1 (B:) Hypothetical protein YppE {Bacillus subtilis [TaxId: 1423]} mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale likvrrphkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiar
Timeline for d2im8b_: