SCOP 1.73: Domain d2im8a1: 2im8 A:1-123

Lineage for d2im8a1 (2im8 A:1-123)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.26: YppE-like [140415] (1 family)
   flattened bundle at one end with helices 2 and coming in contact and separating helices 1 and 3

5. Family a.24.26.1: YppE-like [140416] (3 proteins)
   Pfam PF08807; DUF1798

6. Protein Hypothetical protein YppE [140421] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [140422] (2 PDB entries)

8. Domain d2im8a1: 2im8 A:1-123 [137506]
   automatically matched to 2HFI A:1-123
   complexed with po4

Details for d2im8a1

PDB Entry: 2im8, 2 Å

PDB Description: X-Ray Crystal Structure of Protein yppE from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR213.

PDB Compounds: (A:) Hypothetical protein yppE

SCOP Domain Sequences for d2im8a1:

Sequence; same for both SEQRES and ATOM records:

>d2im8a1 a.24.26.1 (A:1-123) Hypothetical protein YppE {Bacillus subtilis [TaxId: 1423]}
mlsqtllemteqmievaekgadryqegknsnhsydffetikpaveendelaarwaegale
likvrrpkyvhkeqieavkdnflelvlqsyvhhihkkrfkditesvlytlhavkdeiare
dsr

Timeline for d2im8a1:

• d2im8a1 is new in SCOP 1.73
  
• d2im8a1 appears in SCOP 1.75
  
• d2im8a1 appears in the current release, SCOPe 2.08, called d2im8a_