![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
![]() | Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) ![]() "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
![]() | Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins) |
![]() | Protein Viral RNA polymerase [56695] (17 species) |
![]() | Species Human poliovirus 1 [TaxId:12081] [256393] (8 PDB entries) |
![]() | Domain d2im2a_: 2im2 A: [137504] automated match to d1ra6a_ complexed with acy, na, utp missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2im2 (more details), 2.35 Å
SCOPe Domain Sequences for d2im2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2im2a_ e.8.1.4 (A:) Viral RNA polymerase {Human poliovirus 1 [TaxId: 12081]} geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll awhngeeeynkflakirsvpigraldlpeystlydrwldsf
Timeline for d2im2a_: