Lineage for d2im1a_ (2im1 A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623022Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2623030Protein Viral RNA polymerase [56695] (17 species)
  7. 2623260Species Human poliovirus 1 [TaxId:12081] [256393] (8 PDB entries)
  8. 2623264Domain d2im1a_: 2im1 A: [137503]
    automated match to d1ra6a_
    complexed with acy, ctp, mn, na

Details for d2im1a_

PDB Entry: 2im1 (more details), 2.5 Å

PDB Description: crystal structure of poliovirus polymerase complexed with ctp and mn2+
PDB Compounds: (A:) Poliovirus polymerase

SCOPe Domain Sequences for d2im1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2im1a_ e.8.1.4 (A:) Viral RNA polymerase {Human poliovirus 1 [TaxId: 12081]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlydrwldsf

SCOPe Domain Coordinates for d2im1a_:

Click to download the PDB-style file with coordinates for d2im1a_.
(The format of our PDB-style files is described here.)

Timeline for d2im1a_: