Lineage for d2im1a1 (2im1 A:1-461)

  1. Root: SCOP 1.73
  2. 742018Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)
  3. 743030Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 743031Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 743413Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (2 proteins)
  6. 743421Protein Viral RNA polymerase [56695] (9 species)
  7. 743485Species Poliovirus type 1, strain Mahoney [TaxId:12080] [56696] (12 PDB entries)
  8. 743495Domain d2im1a1: 2im1 A:1-461 [137503]
    automatically matched to d1ra6a_
    complexed with acy, cas, ctp, mn, na; mutant

Details for d2im1a1

PDB Entry: 2im1 (more details), 2.5 Å

PDB Description: crystal structure of poliovirus polymerase complexed with ctp and mn2+
PDB Compounds: (A:) Poliovirus polymerase

SCOP Domain Sequences for d2im1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2im1a1 e.8.1.4 (A:1-461) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlydrwldsf

SCOP Domain Coordinates for d2im1a1:

Click to download the PDB-style file with coordinates for d2im1a1.
(The format of our PDB-style files is described here.)

Timeline for d2im1a1: