Lineage for d2ilxa1 (2ilx A:1-219)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726294Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 726295Superfamily d.61.1: LigT-like [55144] (4 families) (S)
  5. 726309Family d.61.1.3: 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103043] (1 protein)
  6. 726310Protein 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103044] (1 species)
  7. 726311Species Rat (Rattus norvegicus) [TaxId:10116] [103045] (1 PDB entry)
  8. 726312Domain d2ilxa1: 2ilx A:1-219 [137499]
    automatically matched to d1n4ta_

Details for d2ilxa1

PDB Entry: 2ilx (more details)

PDB Description: solution structure of catalytic domain of rat 2',3'-cyclic-nucleotide 3'-phosphodiesterase (cnp) protein
PDB Compounds: (A:) 2',3'-cyclic-nucleotide 3'-phosphodiesterase

SCOP Domain Sequences for d2ilxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ilxa1 d.61.1.3 (A:1-219) 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain {Rat (Rattus norvegicus) [TaxId: 10116]}
gshmflplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkekldlvs
yfgkrppgvlhcttkfcdygkatgaeeyaqqdvvrrsygkafklsisalfvtpktagaqv
vlneqelqlwpsdldkpssseslppgsrahvtlgcaadvqpvqtgldlleilqqvkggsq
geevgelprgklyslgkgrwmlslakkmevkaiftgyyg

SCOP Domain Coordinates for d2ilxa1:

Click to download the PDB-style file with coordinates for d2ilxa1.
(The format of our PDB-style files is described here.)

Timeline for d2ilxa1: