Lineage for d2ilxa2 (2ilx A:5-219)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2523189Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2523190Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2523204Family d.61.1.3: 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103043] (2 proteins)
    automatically mapped to Pfam PF05881
  6. 2523205Protein 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103044] (1 species)
  7. 2523206Species Norway rat (Rattus norvegicus) [TaxId:10116] [103045] (2 PDB entries)
  8. 2523208Domain d2ilxa2: 2ilx A:5-219 [137499]
    Other proteins in same PDB: d2ilxa3
    automated match to d2ilxa1

Details for d2ilxa2

PDB Entry: 2ilx (more details)

PDB Description: Solution structure of catalytic domain of rat 2',3'-cyclic-nucleotide 3'-phosphodiesterase (CNP) protein
PDB Compounds: (A:) 2',3'-cyclic-nucleotide 3'-phosphodiesterase

SCOPe Domain Sequences for d2ilxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ilxa2 d.61.1.3 (A:5-219) 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flplyfgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkekldlvsyfgk
rppgvlhcttkfcdygkatgaeeyaqqdvvrrsygkafklsisalfvtpktagaqvvlne
qelqlwpsdldkpssseslppgsrahvtlgcaadvqpvqtgldlleilqqvkggsqgeev
gelprgklyslgkgrwmlslakkmevkaiftgyyg

SCOPe Domain Coordinates for d2ilxa2:

Click to download the PDB-style file with coordinates for d2ilxa2.
(The format of our PDB-style files is described here.)

Timeline for d2ilxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ilxa3