![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) ![]() |
![]() | Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins) |
![]() | Protein Bowman-Birk inhibitor, BBI [57249] (8 species) duplication: consists of two sequence repeats each having this fold |
![]() | Species Snail medic (Medicago scutellata) [TaxId:36901] [90147] (2 PDB entries) |
![]() | Domain d2ilni_: 2iln I: [137495] Other proteins in same PDB: d2ilna_, d2ilnb_ automated match to d1mvza_ |
PDB Entry: 2iln (more details), 2 Å
SCOPe Domain Sequences for d2ilni_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ilni_ g.3.13.1 (I:) Bowman-Birk inhibitor, BBI {Snail medic (Medicago scutellata) [TaxId: 36901]} ccdfcpctrsippqcqctdvrekchsacksclctrsfppqcrcyditdfcyps
Timeline for d2ilni_: