SCOPe 2.01: Domain d2ilni_: 2iln I:

Lineage for d2ilni_ (2iln I:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein)

6. Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
   duplication: consists of two sequence repeats each having this fold

7. Species Snail medic (Medicago scutellata) [TaxId:36901] [90147] (2 PDB entries)

8. Domain d2ilni_: 2iln I: [137495]
   Other proteins in same PDB: d2ilna_, d2ilnb_
   automated match to d1mvza_

Details for d2ilni_

PDB Entry: 2iln, 2 Å

PDB Description: crystal structure of the bowman-birk inhibitor from snail medic seeds in complex with bovine trypsin

PDB Compounds: (I:) bowman-birk type proteinase inhibitor

SCOPe Domain Sequences for d2ilni_:

Sequence; same for both SEQRES and ATOM records:

>d2ilni_ g.3.13.1 (I:) Bowman-Birk inhibitor, BBI {Snail medic (Medicago scutellata) [TaxId: 36901]}
ccdfcpctrsippqcqctdvrekchsacksclctrsfppqcrcyditdfcyps

Timeline for d2ilni_:

• d2ilni_ first appeared in SCOP 1.73, called d2ilni1
  
• d2ilni_ was called d2ilni1 in SCOP 1.75
  
• d2ilni_ appears in SCOPe 2.02
  
• d2ilni_ appears in the current release, SCOPe 2.08