SCOP 1.73: Domain d2ilni1: 2iln I:8-60

Lineage for d2ilni1 (2iln I:8-60)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family)

5. Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein)

6. Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
   duplication: consists of two sequence repeats each having this fold

7. Species Snail medic (Medicago scutellata) [TaxId:36901] [90147] (2 PDB entries)

8. Domain d2ilni1: 2iln I:8-60 [137495]
   Other proteins in same PDB: d2ilna1, d2ilnb1
   automatically matched to d1mvza_

Details for d2ilni1

PDB Entry: 2iln, 2 Å

PDB Description: crystal structure of the bowman-birk inhibitor from snail medic seeds in complex with bovine trypsin

PDB Compounds: (I:) bowman-birk type proteinase inhibitor

SCOP Domain Sequences for d2ilni1:

Sequence; same for both SEQRES and ATOM records:

>d2ilni1 g.3.13.1 (I:8-60) Bowman-Birk inhibitor, BBI {Snail medic (Medicago scutellata) [TaxId: 36901]}
ccdfcpctrsippqcqctdvrekchsacksclctrsfppqcrcyditdfcyps

Timeline for d2ilni1:

• d2ilni1 is new in SCOP 1.73
  
• d2ilni1 appears in SCOP 1.75
  
• d2ilni1 appears in the current release, SCOPe 2.08, called d2ilni_