![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) ![]() |
![]() | Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein) |
![]() | Protein Bowman-Birk inhibitor, BBI [57249] (8 species) duplication: consists of two sequence repeats each having this fold |
![]() | Species Snail medic (Medicago scutellata) [TaxId:36901] [90147] (2 PDB entries) |
![]() | Domain d2ilni1: 2iln I:8-60 [137495] Other proteins in same PDB: d2ilna1, d2ilnb1 automatically matched to d1mvza_ |
PDB Entry: 2iln (more details), 2 Å
SCOP Domain Sequences for d2ilni1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ilni1 g.3.13.1 (I:8-60) Bowman-Birk inhibitor, BBI {Snail medic (Medicago scutellata) [TaxId: 36901]} ccdfcpctrsippqcqctdvrekchsacksclctrsfppqcrcyditdfcyps
Timeline for d2ilni1: