Lineage for d2ilni1 (2iln I:8-60)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 748132Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (1 family) (S)
  5. 748133Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (1 protein)
  6. 748134Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 748147Species Snail medic (Medicago scutellata) [TaxId:36901] [90147] (2 PDB entries)
  8. 748148Domain d2ilni1: 2iln I:8-60 [137495]
    Other proteins in same PDB: d2ilna1, d2ilnb1
    automatically matched to d1mvza_

Details for d2ilni1

PDB Entry: 2iln (more details), 2 Å

PDB Description: crystal structure of the bowman-birk inhibitor from snail medic seeds in complex with bovine trypsin
PDB Compounds: (I:) bowman-birk type proteinase inhibitor

SCOP Domain Sequences for d2ilni1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ilni1 g.3.13.1 (I:8-60) Bowman-Birk inhibitor, BBI {Snail medic (Medicago scutellata) [TaxId: 36901]}
ccdfcpctrsippqcqctdvrekchsacksclctrsfppqcrcyditdfcyps

SCOP Domain Coordinates for d2ilni1:

Click to download the PDB-style file with coordinates for d2ilni1.
(The format of our PDB-style files is described here.)

Timeline for d2ilni1: