Lineage for d2ilni_ (2iln I:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031913Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 3031914Family g.3.13.1: Bowman-Birk inhibitor, BBI [57248] (2 proteins)
  6. 3031915Protein Bowman-Birk inhibitor, BBI [57249] (8 species)
    duplication: consists of two sequence repeats each having this fold
  7. 3031929Species Snail medic (Medicago scutellata) [TaxId:36901] [90147] (2 PDB entries)
  8. 3031930Domain d2ilni_: 2iln I: [137495]
    Other proteins in same PDB: d2ilna_, d2ilnb_
    automated match to d1mvza_

Details for d2ilni_

PDB Entry: 2iln (more details), 2 Å

PDB Description: crystal structure of the bowman-birk inhibitor from snail medic seeds in complex with bovine trypsin
PDB Compounds: (I:) bowman-birk type proteinase inhibitor

SCOPe Domain Sequences for d2ilni_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ilni_ g.3.13.1 (I:) Bowman-Birk inhibitor, BBI {Snail medic (Medicago scutellata) [TaxId: 36901]}
ccdfcpctrsippqcqctdvrekchsacksclctrsfppqcrcyditdfcyps

SCOPe Domain Coordinates for d2ilni_:

Click to download the PDB-style file with coordinates for d2ilni_.
(The format of our PDB-style files is described here.)

Timeline for d2ilni_: