Lineage for d2ilnb_ (2iln B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein Trypsin(ogen) [50515] (9 species)
  7. Species Cow (Bos taurus) [TaxId:9913] [50516] (497 PDB entries)
    Uniprot P00760
  8. Domain d2ilnb_: 2iln B: [137494]
    Other proteins in same PDB: d2ilni_
    automated match to d1aq7__

Details for d2ilnb_

PDB Entry: 2iln (more details), 2 Å

PDB Description: crystal structure of the bowman-birk inhibitor from snail medic seeds in complex with bovine trypsin
PDB Compounds: (B:) cationic trypsin

SCOPe Domain Sequences for d2ilnb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ilnb_ b.47.1.2 (B:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d2ilnb_ are not available.

Timeline for d2ilnb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ilna_, d2ilni_