![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) ![]() |
![]() | Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
![]() | Protein automated matches [190169] (7 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188399] (46 PDB entries) |
![]() | Domain d2ikga_: 2ikg A: [137488] automated match to d1pwla_ complexed with bto, nap |
PDB Entry: 2ikg (more details), 1.43 Å
SCOPe Domain Sequences for d2ikga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ikga_ c.1.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} masrillnngakmpilglgtwksppgqvteavkvaidvgyrhidcahvyqnenevgvaiq eklreqvvkreelfivsklwctyhekglvkgacqktlsdlkldyldlylihwptgfkpgk effpldesgnvvpsdtnildtwaameelvdeglvkaigisnfnhlqvemilnkpglkykp avnqiechpyltqekliqycqskgivvtaysplgspdrpwakpedpslledprikaiaak hnkttaqvlirfpmqrnlvvipksvtperiaenfkvfdfelssqdmttllsynrnwrvca llsctshkdypfheef
Timeline for d2ikga_: