SCOPe 2.08: Domain d2ijqa1: 2ijq A:14-158

Lineage for d2ijqa1 (2ijq A:14-158)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.2: TTHA0068-like [140663] (1 family)

5. Family a.246.2.1: TTHA0068-like [140664] (3 proteins)
   Pfam PF03745; DUF309

6. Protein Hypothetical protein rrnAC1037 [140665] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [140666] (1 PDB entry)
   Uniprot Q5V3A0 15-159

8. Domain d2ijqa1: 2ijq A:14-158 [137481]
   Other proteins in same PDB: d2ijqb_

Details for d2ijqa1

PDB Entry: 2ijq, 1.88 Å

PDB Description: crystal structure of protein rrnac1037 from haloarcula marismortui, pfam duf309

PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2ijqa1:

Sequence; same for both SEQRES and ATOM records:

>d2ijqa1 a.246.2.1 (A:14-158) Hypothetical protein rrnAC1037 {Haloarcula marismortui [TaxId: 2238]}
gnpsgwrtdgqwehetlrravvhgvrlynsgefheshdcfedewynygrgnteskflhgm
vqvaagaykhfdfedddgmrslfrtslqyfrgvpndyygvdlldvrttvtnalsdpsalh
gwqirldgeyptcrpediefaesle

Timeline for d2ijqa1:

• d2ijqa1 first appeared in SCOP 1.73
  
• d2ijqa1 appears in SCOPe 2.07