Lineage for d2ijd22 (2ijd 2:184-644)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2572036Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2572044Protein Viral RNA polymerase [56695] (17 species)
  7. 2572313Species Poliovirus type 1, strain Mahoney [TaxId:12080] [56696] (12 PDB entries)
    Uniprot P03300 1748-2208
  8. 2572323Domain d2ijd22: 2ijd 2:184-644 [137477]
    Other proteins in same PDB: d2ijd11, d2ijd21
    automatically matched to d1ra6a_
    complexed with so4, zn

Details for d2ijd22

PDB Entry: 2ijd (more details), 3.4 Å

PDB Description: Crystal Structure of the Poliovirus Precursor Protein 3CD
PDB Compounds: (2:) Picornain 3C, RNA-directed RNA polymerase

SCOPe Domain Sequences for d2ijd22:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ijd22 e.8.1.4 (2:184-644) Viral RNA polymerase {Poliovirus type 1, strain Mahoney [TaxId: 12080]}
geiqwmrpskevgypiinapsktklepsafhyvfegvkepavltkndprlktdfeeaifs
kyvgnkitevdeymkeavdhyagqlmsldinteqmcledamygtdglealdlstsagypy
vamgkkkrdilnkqtrdtkemqklldtyginlplvtyvkdelrsktkveqgksrlieass
lndsvamrmafgnlyaafhknpgvitgsavgcdpdlfwskipvlmeeklfafdytgydas
lspawfealkmvlekigfgdrvdyidylnhshhlyknktycvkggmpsgcsgtsifnsmi
nnliirtlllktykgidldhlkmiaygddviasyphevdasllaqsgkdygltmtpadks
atfetvtwenvtflkrffradekypflihpvmpmkeihesirwtkdprntqdhvrslcll
awhngeeeynkflakirsvpigraldlpeystlydrwldsf

SCOPe Domain Coordinates for d2ijd22:

Click to download the PDB-style file with coordinates for d2ijd22.
(The format of our PDB-style files is described here.)

Timeline for d2ijd22:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ijd21