![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins) |
![]() | Protein 3C cysteine protease (picornain 3C) [50604] (3 species) |
![]() | Species Human poliovirus 1 Mahoney [TaxId:12081] [74978] (2 PDB entries) |
![]() | Domain d2ijd21: 2ijd 2:1-180 [137476] Other proteins in same PDB: d2ijd12, d2ijd22 automatically matched to d1l1na_ complexed with so4, zn; mutant |
PDB Entry: 2ijd (more details), 3.4 Å
SCOP Domain Sequences for d2ijd21:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ijd21 b.47.1.4 (2:1-180) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkevailaak aladqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt eqgylnlggrqtartlmynfptragqaggvitctgkvigmhvggngshgfaaalkrsyft
Timeline for d2ijd21: