SCOP 1.73: Domain d2ijd21: 2ijd 2:1-180

Lineage for d2ijd21 (2ijd 2:1-180)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)

6. Protein 3C cysteine protease (picornain 3C) [50604] (3 species)

7. Species Human poliovirus 1 Mahoney [TaxId:12081] [74978] (2 PDB entries)

8. Domain d2ijd21: 2ijd 2:1-180 [137476]
   Other proteins in same PDB: d2ijd12, d2ijd22
   automatically matched to d1l1na_
   complexed with so4, zn; mutant

Details for d2ijd21

PDB Entry: 2ijd, 3.4 Å

PDB Description: crystal structure of the poliovirus precursor protein 3cd

PDB Compounds: (2:) Picornain 3C, RNA-directed RNA polymerase

SCOP Domain Sequences for d2ijd21:

Sequence; same for both SEQRES and ATOM records:

>d2ijd21 b.47.1.4 (2:1-180) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]}
gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkevailaak
aladqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt
eqgylnlggrqtartlmynfptragqaggvitctgkvigmhvggngshgfaaalkrsyft

Timeline for d2ijd21:

• d2ijd21 is new in SCOP 1.73
  
• d2ijd21 appears in SCOP 1.75
  
• d2ijd21 appears in the current release, SCOPe 2.08