Lineage for d2ijd11 (2ijd 1:1-180)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 671623Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (3 proteins)
  6. 671628Protein 3C cysteine protease (picornain 3C) [50604] (3 species)
  7. 671641Species Human poliovirus 1 Mahoney [TaxId:12081] [74978] (2 PDB entries)
  8. 671644Domain d2ijd11: 2ijd 1:1-180 [137474]
    Other proteins in same PDB: d2ijd12, d2ijd22
    automatically matched to d1l1na_
    complexed with so4, zn; mutant

Details for d2ijd11

PDB Entry: 2ijd (more details), 3.4 Å

PDB Description: crystal structure of the poliovirus precursor protein 3cd
PDB Compounds: (1:) Picornain 3C, RNA-directed RNA polymerase

SCOP Domain Sequences for d2ijd11:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ijd11 b.47.1.4 (1:1-180) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]}
gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkevailaak
aladqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt
eqgylnlggrqtartlmynfptragqaggvitctgkvigmhvggngshgfaaalkrsyft

SCOP Domain Coordinates for d2ijd11:

Click to download the PDB-style file with coordinates for d2ijd11.
(The format of our PDB-style files is described here.)

Timeline for d2ijd11:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ijd12