SCOPe 2.08: Domain d2ijd11: 2ijd 1:1-180

Lineage for d2ijd11 (2ijd 1:1-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein 3C cysteine protease (picornain 3C) [50604] (9 species)

7. Species Human poliovirus 1 Mahoney [TaxId:12081] [74978] (2 PDB entries)

8. Domain d2ijd11: 2ijd 1:1-180 [137474]
   Other proteins in same PDB: d2ijd12, d2ijd22
   automatically matched to d1l1na_
   complexed with so4, zn

Details for d2ijd11

PDB Entry: 2ijd, 3.4 Å

PDB Description: crystal structure of the poliovirus precursor protein 3cd

PDB Compounds: (1:) Picornain 3C, RNA-directed RNA polymerase

SCOPe Domain Sequences for d2ijd11:

Sequence; same for both SEQRES and ATOM records:

>d2ijd11 b.47.1.4 (1:1-180) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]}
gpgfdyavamakrnivtattskgeftmlgvhdnvailpthaspgesividgkevailaak
aladqagtnleitiitlkrnekfrdirphiptqitetndgvlivntskypnmyvpvgavt
eqgylnlggrqtartlmynfptragqaggvitctgkvigmhvggngshgfaaalkrsyft

Timeline for d2ijd11:

• d2ijd11 first appeared in SCOP 1.73
  
• d2ijd11 appears in SCOPe 2.07